PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1209s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 290aa    MW: 31937.9 Da    PI: 6.4998
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1209s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.72.2e-371468761
                  zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                            +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  SapurV1A.1209s0110.1.p 14 SCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 68
                            7***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-26167IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7141367IPR003851Zinc finger, Dof-type
PfamPF027011.9E-311467IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
METGWKGSAE LSPSCPRCGS SNTKFCYYNN YSLTQPRYFC KGCRRYWTKG GSLRNVPVGG  60
GCRKNRRGKS LRLSSNDHHS KSFGYGGLPN NSVRHPYIHK GNSSTESSSS PTIPDGSHID  120
LALVYAKFLN PQQDSKSDSE GPEFTSEFDP SLIFPNISNT KVGPSSRLSE ENDLAGCLTI  180
SDFSTEAPLS DNDHLMYCYS LESAHKHQDH QDRTEHCTSN DTSSFNLPPL PGQETASQET  240
LWSFSHLMGN HSLGMSQQPV LGPETQDPNV LFGNWSPFDL SSDDTFSRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002309254.10.0hypothetical protein POPTR_0006s21700g
TrEMBLB9H9K80.0B9H9K8_POPTR; Uncharacterized protein
STRINGPOPTR_0006s21700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.17e-53Dof family protein